PTM Viewer PTM Viewer

AT5G39120.1

Arabidopsis thaliana [ath]

RmlC-like cupins superfamily protein

No PTMs currently found

PLAZA: AT5G39120
Gene Family: HOM05D000052
Other Names: NULL

Link out to other resources with this protein ID : TAIR   |   PeptideAtlas   |   ARAPORT   |   PhosPhAt

PTMs

There are no stored PTMs for this protein

Sequence

Length: 221

MKVSMSLILITFWALVTIAKAYDPSPLQDFCVAIDDPKNGVFVNGKFCKDPKQAKAEDFFSSGLNQAGITNNKVKSNVTTVNVDQIPGLNTLGISLVRIDYAPYGQNPPHTHPRATEILVLVEGTLYVGFVSSNQDNNRLFAKVLNPGDVFVFPIGMIHFQVNIGKTPAVAFAGLSSQNAGVITIADTVFGSTPPINPDILAQAFQLDVNVVKDLEAKFKN

Domains & Sites

Clear highlighted range 
Interpro Domains
Show IPR ID From To
IPR006045 62 213
Molecule Processing
Show Type From To
Signal Peptide 1 21
Sites
Show Type Position
Active Site 110
Active Site 112
Active Site 117
Active Site 159
Active Site 107
Active Site 112
Active Site 117

BLAST


Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here